SCOPe 2.07: Domain d2f2ga_: 2f2g A:

Lineage for d2f2ga_ (2f2g A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Seed maturation protein-related At3g16990 [101461] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101462] (2 PDB entries)
   structural genomics

8. Domain d2f2ga_: 2f2g A: [132816]
   automated match to d1q4mb_
   complexed with hmh, so4

Details for d2f2ga_

PDB Entry: 2f2g, 2.1 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at3g16990

PDB Compounds: (A:) seed maturation protein pm36 homolog

SCOPe Domain Sequences for d2f2ga_:

Sequence; same for both SEQRES and ATOM records:

>d2f2ga_ a.132.1.3 (A:) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvlir
ackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlms
sevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvknia
erclenasgevlgeaedvlvrvlelevafwemsrg

Timeline for d2f2ga_:

• d2f2ga_ first appeared in SCOP 1.73, called d2f2ga1
  
• d2f2ga_ appears in SCOPe 2.06
  
• d2f2ga_ appears in the current release, SCOPe 2.08