Lineage for d2f2ff1 (2f2f F:25-178)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669060Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 669245Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 669246Family b.42.2.1: Ricin B-like [50371] (7 protein domains)
  6. 669253Protein Cytolethal distending toxin subunit C [110209] (2 species)
  7. 669254Species Actinobacillus actinomycetemcomitans [TaxId:714] [141330] (1 PDB entry)
  8. 669256Domain d2f2ff1: 2f2f F:25-178 [132815]
    Other proteins in same PDB: d2f2fa1, d2f2fb1, d2f2fd1, d2f2fe1
    automatically matched to 2F2F C:25-178

Details for d2f2ff1

PDB Entry: 2f2f (more details), 2.4 Å

PDB Description: crystal structure of cytolethal distending toxin (cdt) from actinobacillus actinomycetemcomitans
PDB Compounds: (F:) cytolethal distending toxin C

SCOP Domain Sequences for d2f2ff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2ff1 b.42.2.1 (F:25-178) Cytolethal distending toxin subunit C {Actinobacillus actinomycetemcomitans [TaxId: 714]}
dpttypdvelsppprislrslltaqpikndhydshnylsthwelidykgkeyeklrdggt
lvqfkvvgaakcfafpgegttdckdidhtvfnliptntgaflikdallgfcmtshdfddl
rlepcgisvsgrtfslayqwgilppfgpskilrp

SCOP Domain Coordinates for d2f2ff1:

Click to download the PDB-style file with coordinates for d2f2ff1.
(The format of our PDB-style files is described here.)

Timeline for d2f2ff1: