Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Cytolethal distending toxin subunit C [110209] (2 species) |
Species Actinobacillus actinomycetemcomitans [TaxId:714] [141330] (1 PDB entry) Uniprot Q7DK11 25-178 |
Domain d2f2ff_: 2f2f F: [132815] Other proteins in same PDB: d2f2fa1, d2f2fb1, d2f2fd_, d2f2fe_ automated match to d2f2fc1 |
PDB Entry: 2f2f (more details), 2.4 Å
SCOPe Domain Sequences for d2f2ff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2ff_ b.42.2.1 (F:) Cytolethal distending toxin subunit C {Actinobacillus actinomycetemcomitans [TaxId: 714]} dpttypdvelsppprislrslltaqpikndhydshnylsthwelidykgkeyeklrdggt lvqfkvvgaakcfafpgegttdckdidhtvfnliptntgaflikdallgfcmtshdfddl rlepcgisvsgrtfslayqwgilppfgpskilrp
Timeline for d2f2ff_: