Lineage for d2f2fe1 (2f2f E:23-283)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875502Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 875503Superfamily d.151.1: DNase I-like [56219] (3 families) (S)
  5. 875504Family d.151.1.1: DNase I-like [56220] (6 proteins)
  6. 875505Protein Cytolethal distending toxin subunit B [111213] (3 species)
  7. 875506Species Actinobacillus actinomycetemcomitans [TaxId:714] [143900] (1 PDB entry)
    Uniprot Q7DK12 23-283
  8. 875508Domain d2f2fe1: 2f2f E:23-283 [132814]
    Other proteins in same PDB: d2f2fa1, d2f2fc1, d2f2fd1, d2f2ff1
    automatically matched to 2F2F B:23-283

Details for d2f2fe1

PDB Entry: 2f2f (more details), 2.4 Å

PDB Description: crystal structure of cytolethal distending toxin (cdt) from actinobacillus actinomycetemcomitans
PDB Compounds: (E:) Cytolethal distending toxin B

SCOP Domain Sequences for d2f2fe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2fe1 d.151.1.1 (E:23-283) Cytolethal distending toxin subunit B {Actinobacillus actinomycetemcomitans [TaxId: 714]}
nlsdfkvatwnlqgssavneskwninvrqllsgeqgadilmvqeagslpssavrtsrviq
hggtpieeytwnlgtrsrpnmvyiyysrldvganrvnlaivsrrqadeafivhsdssvlq
srpavgirigtdvfftvhalatggsdavslirnifttftsspssperrgyswmvvgdfnr
apvnleaalrqepavsentiiiaptepthrsgnildyailhdahlprreqarerigaslm
lnqlrsqitsdhfpvsfvhdr

SCOP Domain Coordinates for d2f2fe1:

Click to download the PDB-style file with coordinates for d2f2fe1.
(The format of our PDB-style files is described here.)

Timeline for d2f2fe1: