Lineage for d2f2fe_ (2f2f E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548551Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2548552Protein Cytolethal distending toxin subunit B [111213] (3 species)
  7. 2548553Species Actinobacillus actinomycetemcomitans [TaxId:714] [143900] (1 PDB entry)
    Uniprot Q7DK12 23-283
  8. 2548555Domain d2f2fe_: 2f2f E: [132814]
    Other proteins in same PDB: d2f2fa1, d2f2fc1, d2f2fd_, d2f2ff_
    automated match to d2f2fb1

Details for d2f2fe_

PDB Entry: 2f2f (more details), 2.4 Å

PDB Description: crystal structure of cytolethal distending toxin (cdt) from actinobacillus actinomycetemcomitans
PDB Compounds: (E:) Cytolethal distending toxin B

SCOPe Domain Sequences for d2f2fe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2fe_ d.151.1.1 (E:) Cytolethal distending toxin subunit B {Actinobacillus actinomycetemcomitans [TaxId: 714]}
nlsdfkvatwnlqgssavneskwninvrqllsgeqgadilmvqeagslpssavrtsrviq
hggtpieeytwnlgtrsrpnmvyiyysrldvganrvnlaivsrrqadeafivhsdssvlq
srpavgirigtdvfftvhalatggsdavslirnifttftsspssperrgyswmvvgdfnr
apvnleaalrqepavsentiiiaptepthrsgnildyailhdahlprreqarerigaslm
lnqlrsqitsdhfpvsfvhdr

SCOPe Domain Coordinates for d2f2fe_:

Click to download the PDB-style file with coordinates for d2f2fe_.
(The format of our PDB-style files is described here.)

Timeline for d2f2fe_: