Lineage for d2f2fd1 (2f2f D:71-223)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126115Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1126347Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 1126348Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1126362Protein Cytolethal distending toxin subunit A [110207] (2 species)
  7. 1126363Species Actinobacillus actinomycetemcomitans [TaxId:714] [141329] (1 PDB entry)
    Uniprot O87120 70-222
  8. 1126365Domain d2f2fd1: 2f2f D:71-223 [132813]
    Other proteins in same PDB: d2f2fb1, d2f2fc1, d2f2fe1, d2f2ff1
    automatically matched to 2F2F A:71-223

Details for d2f2fd1

PDB Entry: 2f2f (more details), 2.4 Å

PDB Description: crystal structure of cytolethal distending toxin (cdt) from actinobacillus actinomycetemcomitans
PDB Compounds: (D:) Cytolethal distending toxin A

SCOPe Domain Sequences for d2f2fd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2fd1 b.42.2.1 (D:71-223) Cytolethal distending toxin subunit A {Actinobacillus actinomycetemcomitans [TaxId: 714]}
psepsnfmtlmgqngalltvwalakrnwlwaypniysqdfgnirnwkiepgkhreyfrfv
nqslgtcieaygnglihdtcsldklaqefellptdsgavviksvsqgrcvtynpvsptyy
stvtlstcdgateplrdqtwylappvleatavn

SCOPe Domain Coordinates for d2f2fd1:

Click to download the PDB-style file with coordinates for d2f2fd1.
(The format of our PDB-style files is described here.)

Timeline for d2f2fd1: