SCOPe 2.02: Domain d2f2fc1: 2f2f C:25-178

Lineage for d2f2fc1 (2f2f C:25-178)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (3 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Cytolethal distending toxin subunit C [110209] (2 species)

7. Species Actinobacillus actinomycetemcomitans [TaxId:714] [141330] (1 PDB entry)
   Uniprot Q7DK11 25-178

8. Domain d2f2fc1: 2f2f C:25-178 [132812]
   Other proteins in same PDB: d2f2fa1, d2f2fb1, d2f2fd1, d2f2fe1

Details for d2f2fc1

PDB Entry: 2f2f, 2.4 Å

PDB Description: crystal structure of cytolethal distending toxin (cdt) from actinobacillus actinomycetemcomitans

PDB Compounds: (C:) cytolethal distending toxin C

SCOPe Domain Sequences for d2f2fc1:

Sequence; same for both SEQRES and ATOM records:

>d2f2fc1 b.42.2.1 (C:25-178) Cytolethal distending toxin subunit C {Actinobacillus actinomycetemcomitans [TaxId: 714]}
dpttypdvelsppprislrslltaqpikndhydshnylsthwelidykgkeyeklrdggt
lvqfkvvgaakcfafpgegttdckdidhtvfnliptntgaflikdallgfcmtshdfddl
rlepcgisvsgrtfslayqwgilppfgpskilrp

Timeline for d2f2fc1:

• d2f2fc1 first appeared in SCOP 1.73
  
• d2f2fc1 appears in SCOPe 2.01
  
• d2f2fc1 appears in SCOPe 2.03
  
• d2f2fc1 appears in the current release, SCOPe 2.08