SCOPe 2.03: Domain d2f2fa1: 2f2f A:71-223

Lineage for d2f2fa1 (2f2f A:71-223)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Cytolethal distending toxin subunit A [110207] (2 species)

7. Species Actinobacillus actinomycetemcomitans [TaxId:714] [141329] (1 PDB entry)
   Uniprot O87120 70-222

8. Domain d2f2fa1: 2f2f A:71-223 [132810]
   Other proteins in same PDB: d2f2fb1, d2f2fc1, d2f2fe_, d2f2ff_

Details for d2f2fa1

PDB Entry: 2f2f, 2.4 Å

PDB Description: crystal structure of cytolethal distending toxin (cdt) from actinobacillus actinomycetemcomitans

PDB Compounds: (A:) Cytolethal distending toxin A

SCOPe Domain Sequences for d2f2fa1:

Sequence; same for both SEQRES and ATOM records:

>d2f2fa1 b.42.2.1 (A:71-223) Cytolethal distending toxin subunit A {Actinobacillus actinomycetemcomitans [TaxId: 714]}
psepsnfmtlmgqngalltvwalakrnwlwaypniysqdfgnirnwkiepgkhreyfrfv
nqslgtcieaygnglihdtcsldklaqefellptdsgavviksvsqgrcvtynpvsptyy
stvtlstcdgateplrdqtwylappvleatavn

Timeline for d2f2fa1:

• d2f2fa1 first appeared in SCOP 1.73
  
• d2f2fa1 appears in SCOPe 2.02
  
• d2f2fa1 appears in SCOPe 2.04
  
• d2f2fa1 appears in the current release, SCOPe 2.08