![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (7 proteins) |
![]() | Protein Cytolethal distending toxin subunit A [110207] (2 species) |
![]() | Species Actinobacillus actinomycetemcomitans [TaxId:714] [141329] (1 PDB entry) |
![]() | Domain d2f2fa1: 2f2f A:71-223 [132810] Other proteins in same PDB: d2f2fb1, d2f2fc1, d2f2fe1, d2f2ff1 |
PDB Entry: 2f2f (more details), 2.4 Å
SCOP Domain Sequences for d2f2fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2fa1 b.42.2.1 (A:71-223) Cytolethal distending toxin subunit A {Actinobacillus actinomycetemcomitans [TaxId: 714]} psepsnfmtlmgqngalltvwalakrnwlwaypniysqdfgnirnwkiepgkhreyfrfv nqslgtcieaygnglihdtcsldklaqefellptdsgavviksvsqgrcvtynpvsptyy stvtlstcdgateplrdqtwylappvleatavn
Timeline for d2f2fa1: