![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.69: HxlR-like [140304] (5 proteins) Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family ((46801)) |
![]() | Protein Hypothetical protein PA1607 [140307] (1 species) includes extra C-terminal SH3-like subdomain, which is segment-swapped in the dimer |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [140308] (1 PDB entry) Uniprot Q9I3B4 5-146 |
![]() | Domain d2f2eb1: 2f2e B:6-145 [132809] automatically matched to 2F2E A:5-146 complexed with glc, so4 |
PDB Entry: 2f2e (more details), 1.85 Å
SCOP Domain Sequences for d2f2eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2eb1 a.4.5.69 (B:6-145) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]} shkqascpvarpldvigdgwsmlivrdafegltrfgefqkslglaknilaarlrnlvehg vmvavpaesgshqeyrltdkgralfpllvairqwgedyffapdeshvrlverdsgqpvpr lqvragdgsplaaedtrvsr
Timeline for d2f2eb1: