SCOP 1.75: Domain d2f2eb1: 2f2e B:6-145

Lineage for d2f2eb1 (2f2e B:6-145)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.69: HxlR-like [140304] (5 proteins)
   Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family ((46801))

6. Protein Hypothetical protein PA1607 [140307] (1 species)
   includes extra C-terminal SH3-like subdomain, which is segment-swapped in the dimer

7. Species Pseudomonas aeruginosa [TaxId:287] [140308] (1 PDB entry)
   Uniprot Q9I3B4 5-146

8. Domain d2f2eb1: 2f2e B:6-145 [132809]
   automatically matched to 2F2E A:5-146
   complexed with glc, so4

Details for d2f2eb1

PDB Entry: 2f2e, 1.85 Å

PDB Description: crystal structure of pa1607, a putative transcription factor

PDB Compounds: (B:) pa1607

SCOP Domain Sequences for d2f2eb1:

Sequence; same for both SEQRES and ATOM records:

>d2f2eb1 a.4.5.69 (B:6-145) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]}
shkqascpvarpldvigdgwsmlivrdafegltrfgefqkslglaknilaarlrnlvehg
vmvavpaesgshqeyrltdkgralfpllvairqwgedyffapdeshvrlverdsgqpvpr
lqvragdgsplaaedtrvsr

Timeline for d2f2eb1:

• d2f2eb1 first appeared in SCOP 1.73
  
• d2f2eb1 is called d2f2eb_ in SCOPe 2.01
  
• d2f2eb1 appears in the current release, SCOPe 2.08, called d2f2eb_