Lineage for d2f2ea1 (2f2e A:5-146)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762991Family a.4.5.69: HxlR-like [140304] (5 proteins)
    Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family ((46801))
  6. 762996Protein Hypothetical protein PA1607 [140307] (1 species)
    includes extra C-terminal SH3-like subdomain, which is segment-swapped in the dimer
  7. 762997Species Pseudomonas aeruginosa [TaxId:287] [140308] (1 PDB entry)
    Uniprot Q9I3B4 5-146
  8. 762998Domain d2f2ea1: 2f2e A:5-146 [132808]
    complexed with glc, so4

Details for d2f2ea1

PDB Entry: 2f2e (more details), 1.85 Å

PDB Description: crystal structure of pa1607, a putative transcription factor
PDB Compounds: (A:) pa1607

SCOP Domain Sequences for d2f2ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]}
tshkqascpvarpldvigdgwsmlivrdafegltrfgefqkslglaknilaarlrnlveh
gvmvavpaesgshqeyrltdkgralfpllvairqwgedyffapdeshvrlverdsgqpvp
rlqvragdgsplaaedtrvsrd

SCOP Domain Coordinates for d2f2ea1:

Click to download the PDB-style file with coordinates for d2f2ea1.
(The format of our PDB-style files is described here.)

Timeline for d2f2ea1: