![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Viral cyclin [47961] (3 species) |
![]() | Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries) |
![]() | Domain d2f2ca1: 2f2c A:8-148 [132805] Other proteins in same PDB: d2f2cb_ automated match to d1jowa1 complexed with ap9, dms, so4 |
PDB Entry: 2f2c (more details), 2.8 Å
SCOPe Domain Sequences for d2f2ca1:
Sequence, based on SEQRES records: (download)
>d2f2ca1 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcf tnlelinqekdilealkwdte
>d2f2ca1 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnl elinqekdilealkwdte
Timeline for d2f2ca1: