SCOPe 2.07: Domain d2f2ac_: 2f2a C:

Lineage for d2f2ac_ (2f2a C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family)

5. Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
   Pfam PF02686

6. Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries)
   Uniprot P68807 2-100

8. Domain d2f2ac_: 2f2a C: [132804]
   Other proteins in same PDB: d2f2aa_, d2f2ab1, d2f2ab2
   automated match to d2df4c1
   protein/RNA complex; complexed with gln, mg

Details for d2f2ac_

PDB Entry: 2f2a, 2.3 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB complexed with Gln

PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOPe Domain Sequences for d2f2ac_:

Sequence; same for both SEQRES and ATOM records:

>d2f2ac_ a.137.12.1 (C:) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv
lredkaikgipqelalknaketedgqfkvpti

Timeline for d2f2ac_:

• d2f2ac_ first appeared in SCOP 1.73, called d2f2ac1
  
• d2f2ac_ appears in SCOPe 2.06
  
• d2f2ac_ appears in the current release, SCOPe 2.08