Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family) |
Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein) Pfam PF02686 |
Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries) Uniprot P68807 2-100 |
Domain d2f2ac_: 2f2a C: [132804] Other proteins in same PDB: d2f2aa_, d2f2ab1, d2f2ab2 automated match to d2df4c1 protein/RNA complex; complexed with gln, mg |
PDB Entry: 2f2a (more details), 2.3 Å
SCOPe Domain Sequences for d2f2ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2ac_ a.137.12.1 (C:) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]} kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv lredkaikgipqelalknaketedgqfkvpti
Timeline for d2f2ac_: