SCOP 1.75: Domain d2f22b1: 2f22 B:1-141

Lineage for d2f22b1 (2f22 B:1-141)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order

4. Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families)
   contains metal-binding site on the bundle surface surrounded by loops

5. Family a.213.1.2: DinB-like [140603] (4 proteins)
   Pfam PF05163

6. Protein Hypothetical protein BH3987 [140604] (1 species)
   family assignment by RPS BLAST hit; similar to YfiT subunit fold and metal-binding site, but different dimerisation mode

7. Species Bacillus halodurans [TaxId:86665] [140605] (1 PDB entry)
   Uniprot Q9RC77 1-141

8. Domain d2f22b1: 2f22 B:1-141 [132796]
   automatically matched to 2F22 A:1-141
   complexed with na, ni

Details for d2f22b1

PDB Entry: 2f22, 1.42 Å

PDB Description: crystal structure of a putative dna damage-inducable (dinb) protein (bh3987) from bacillus halodurans at 1.42 a resolution

PDB Compounds: (B:) bh3987

SCOP Domain Sequences for d2f22b1:

Sequence; same for both SEQRES and ATOM records:

>d2f22b1 a.213.1.2 (B:1-141) Hypothetical protein BH3987 {Bacillus halodurans [TaxId: 86665]}
mdtngvlyaanmtnalakeipeskwdiqlipelgtlrklfihivrvrdvyrdglktgsik
fpgrlasdehrlldelersmeelvfefkqttfnsikmgenylsimellgtviqhegihqg
qyyvalkqsginlpkqwvqdw

Timeline for d2f22b1:

• d2f22b1 first appeared in SCOP 1.73
  
• d2f22b1 is called d2f22b_ in SCOPe 2.01
  
• d2f22b1 appears in the current release, SCOPe 2.08, called d2f22b_