Lineage for d2f22b1 (2f22 B:1-141)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651335Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order
  4. 651336Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (2 families) (S)
    contains metal-binding site on the bundle surface surrounded by loops
  5. 651344Family a.213.1.2: DinB-like [140603] (1 protein)
    Pfam PF05163
  6. 651345Protein Hypothetical protein BH3987 [140604] (1 species)
    family assignment by RPS BLAST hit; similar to YfiT subunit fold and metal-binding site, but different dimerisation mode
  7. 651346Species Bacillus halodurans [TaxId:86665] [140605] (1 PDB entry)
  8. 651348Domain d2f22b1: 2f22 B:1-141 [132796]
    automatically matched to 2F22 A:1-141
    complexed with na, ni

Details for d2f22b1

PDB Entry: 2f22 (more details), 1.42 Å

PDB Description: crystal structure of a putative dna damage-inducable (dinb) protein (bh3987) from bacillus halodurans at 1.42 a resolution
PDB Compounds: (B:) bh3987

SCOP Domain Sequences for d2f22b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f22b1 a.213.1.2 (B:1-141) Hypothetical protein BH3987 {Bacillus halodurans [TaxId: 86665]}
mdtngvlyaanmtnalakeipeskwdiqlipelgtlrklfihivrvrdvyrdglktgsik
fpgrlasdehrlldelersmeelvfefkqttfnsikmgenylsimellgtviqhegihqg
qyyvalkqsginlpkqwvqdw

SCOP Domain Coordinates for d2f22b1:

Click to download the PDB-style file with coordinates for d2f22b1.
(The format of our PDB-style files is described here.)

Timeline for d2f22b1: