Lineage for d2f21a2 (2f21 A:51-163)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
    Domain 1 is a WW-domain
  7. Species Human (Homo sapiens) [TaxId:9606] [54548] (51 PDB entries)
  8. Domain d2f21a2: 2f21 A:51-163 [132794]
    Other proteins in same PDB: d2f21a1
    automated match to d3tc5a2
    complexed with 1pe; mutant

    has additional insertions and/or extensions that are not grouped together

Details for d2f21a2

PDB Entry: 2f21 (more details), 1.5 Å

PDB Description: human Pin1 Fip mutant
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2f21a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f21a2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

SCOPe Domain Coordinates for d2f21a2 are not available.

Timeline for d2f21a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f21a1