Lineage for d2f21a1 (2f21 A:7-37)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808661Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 808662Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 808663Family b.72.1.1: WW domain [51046] (12 proteins)
  6. 808717Protein Ubiquitin ligase NEDD4 WWIII domain [63837] (2 species)
  7. 808720Species Rat (Rattus norvegicus) [TaxId:10116] [63838] (2 PDB entries)
  8. 808721Domain d2f21a1: 2f21 A:7-37 [132793]
    Other proteins in same PDB: d2f21a2
    automatically matched to d1i5hw_
    complexed with 1pe; mutant

Details for d2f21a1

PDB Entry: 2f21 (more details), 1.5 Å

PDB Description: human pin1 fip mutant
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOP Domain Sequences for d2f21a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f21a1 b.72.1.1 (A:7-37) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]}
lppgwekrmsadgrvyyfnhitnasqwerp

SCOP Domain Coordinates for d2f21a1:

Click to download the PDB-style file with coordinates for d2f21a1.
(The format of our PDB-style files is described here.)

Timeline for d2f21a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f21a2