SCOPe 2.08: Domain d2f21a1: 2f21 A:1-37

Lineage for d2f21a1 (2f21 A:1-37)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.0: automated matches [227264] (1 protein)
   not a true family

6. Protein automated matches [227055] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226058] (20 PDB entries)

8. Domain d2f21a1: 2f21 A:1-37 [132793]
   Other proteins in same PDB: d2f21a2
   automated match to d1f8ab1
   complexed with 1pe; mutant

Details for d2f21a1

PDB Entry: 2f21, 1.5 Å

PDB Description: human pin1 fip mutant

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2f21a1:

Sequence; same for both SEQRES and ATOM records:

>d2f21a1 b.72.1.0 (A:1-37) automated matches {Human (Homo sapiens) [TaxId: 9606]}
madeeklppgwekrmsadgrvyyfnhitnasqwerp

Timeline for d2f21a1:

• d2f21a1 first appeared in SCOP 1.73
  
• d2f21a1 appears in SCOPe 2.07