SCOPe 2.08: Domain d2f20b2: 2f20 B:2-232

Lineage for d2f20b2 (2f20 B:2-232)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.303: BB1717-like [143080] (1 superfamily)
   complex fold with a bifurcated beta-sheet structure surrounded by helices; contains beta-sheet barrel, closed (n=5, S=8)

4. Superfamily d.303.1: BB1717-like [143081] (2 families)

5. Family d.303.1.1: BB1717-like [143082] (4 proteins)
   Pfam PF02586; DUF159, COG2135

6. Protein Hypothetical protein BT1218 [143089] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [143090] (1 PDB entry)
   Uniprot Q8A8E9 2-232

8. Domain d2f20b2: 2f20 B:2-232 [132792]
   Other proteins in same PDB: d2f20a2, d2f20b3
   automated match to d2f20a1

Details for d2f20b2

PDB Entry: 2f20, 2.1 Å

PDB Description: X-ray Crystal Structure of Protein BT_1218 from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR8.

PDB Compounds: (B:) conserved hypothetical protein, with conserved domain

SCOPe Domain Sequences for d2f20b2:

Sequence; same for both SEQRES and ATOM records:

>d2f20b2 d.303.1.1 (B:2-232) Hypothetical protein BT1218 {Bacteroides thetaiotaomicron [TaxId: 818]}
cfhnsmsakaikvaarygrqsdvveiyqsildeqyhvnaftfprypiitssdevqvfnwg
lipfwvrseedateirkmtlnaradtifekpsfrepimkkrcivpstgyfewrheganki
pyyiyvkdepifsmagiydrwldkdtgeehetfsiittdtnsltdyidntkhrmpailtq
eeeekwlnpslskaeiasllkpfdtekmdayvirndflkkspndptivqra

Timeline for d2f20b2:

• d2f20b2 first appeared in SCOP 1.73, called d2f20b1
  
• d2f20b2 appears in SCOPe 2.07