![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.303: BB1717-like [143080] (1 superfamily) complex fold with a bifurcated beta-sheet structure surrounded by helices; contains beta-sheet barrel, closed (n=5, S=8) |
![]() | Superfamily d.303.1: BB1717-like [143081] (2 families) ![]() |
![]() | Family d.303.1.1: BB1717-like [143082] (4 proteins) Pfam PF02586; DUF159, COG2135 |
![]() | Protein Hypothetical protein BT1218 [143089] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [143090] (1 PDB entry) Uniprot Q8A8E9 2-232 |
![]() | Domain d2f20a1: 2f20 A:2-232 [132791] Other proteins in same PDB: d2f20a2, d2f20b3 |
PDB Entry: 2f20 (more details), 2.1 Å
SCOPe Domain Sequences for d2f20a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f20a1 d.303.1.1 (A:2-232) Hypothetical protein BT1218 {Bacteroides thetaiotaomicron [TaxId: 818]} cfhnsmsakaikvaarygrqsdvveiyqsildeqyhvnaftfprypiitssdevqvfnwg lipfwvrseedateirkmtlnaradtifekpsfrepimkkrcivpstgyfewrheganki pyyiyvkdepifsmagiydrwldkdtgeehetfsiittdtnsltdyidntkhrmpailtq eeeekwlnpslskaeiasllkpfdtekmdayvirndflkkspndptivqra
Timeline for d2f20a1: