Lineage for d2f1kd1 (2f1k D:166-279)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006670Family a.100.1.12: TyrA dimerization domain-like [140780] (1 protein)
    new dimerisation mode with swapping of C-terminal helices
  6. 2006671Protein Prephenate dehydrogenase TyrA [140781] (3 species)
  7. 2006680Species Synechocystis sp. PCC 6803 [TaxId:1148] [140783] (1 PDB entry)
    Uniprot P73906 166-279
  8. 2006684Domain d2f1kd1: 2f1k D:166-279 [132778]
    Other proteins in same PDB: d2f1ka2, d2f1kb2, d2f1kc2, d2f1kd2
    automated match to d2f1ka1
    complexed with nap, trs

Details for d2f1kd1

PDB Entry: 2f1k (more details), 1.55 Å

PDB Description: crystal structure of synechocystis arogenate dehydrogenase
PDB Compounds: (D:) prephenate dehydrogenase

SCOPe Domain Sequences for d2f1kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1kd1 a.100.1.12 (D:166-279) Prephenate dehydrogenase TyrA {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tpadhdqavawishlpvmvsaaliqacagekdgdilklaqnlassgfrdtsrvgggnpel
gtmmatynqrallkslqdyrqhldqlitlisnqqwpelhrllqqtngdrdkyve

SCOPe Domain Coordinates for d2f1kd1:

Click to download the PDB-style file with coordinates for d2f1kd1.
(The format of our PDB-style files is described here.)

Timeline for d2f1kd1: