Lineage for d2f1kc2 (2f1k C:1-165)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829821Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 1829936Protein Prephenate dehydrogenase TyrA [141929] (3 species)
  7. 1829945Species Synechocystis sp. PCC 6803 [TaxId:1148] [141931] (1 PDB entry)
    Uniprot P73906 1-165
  8. 1829948Domain d2f1kc2: 2f1k C:1-165 [132777]
    Other proteins in same PDB: d2f1ka1, d2f1kb1, d2f1kc1, d2f1kd1
    automated match to d2f1ka2
    complexed with nap, trs

Details for d2f1kc2

PDB Entry: 2f1k (more details), 1.55 Å

PDB Description: crystal structure of synechocystis arogenate dehydrogenase
PDB Compounds: (C:) prephenate dehydrogenase

SCOPe Domain Sequences for d2f1kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1kc2 c.2.1.6 (C:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. PCC 6803 [TaxId: 1148]}
mkigvvglgligaslagdlrrrghyligvsrqqstcekaverqlvdeagqdlsllqtaki
iflctpiqlilptlekliphlsptaivtdvasvktaiaepasqlwsgfigghpmagtaaq
gidgaeenlfvnapyvltpteytdpeqlaclrsvleplgvkiylc

SCOPe Domain Coordinates for d2f1kc2:

Click to download the PDB-style file with coordinates for d2f1kc2.
(The format of our PDB-style files is described here.)

Timeline for d2f1kc2: