![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
![]() | Protein Prephenate dehydrogenase TyrA [141929] (3 species) |
![]() | Species Synechocystis sp. PCC 6803 [TaxId:1148] [141931] (1 PDB entry) Uniprot P73906 1-165 |
![]() | Domain d2f1kc2: 2f1k C:1-165 [132777] Other proteins in same PDB: d2f1ka1, d2f1kb1, d2f1kc1, d2f1kd1 automatically matched to 2F1K A:1-165 complexed with nap, trs |
PDB Entry: 2f1k (more details), 1.55 Å
SCOPe Domain Sequences for d2f1kc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1kc2 c.2.1.6 (C:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. PCC 6803 [TaxId: 1148]} mkigvvglgligaslagdlrrrghyligvsrqqstcekaverqlvdeagqdlsllqtaki iflctpiqlilptlekliphlsptaivtdvasvktaiaepasqlwsgfigghpmagtaaq gidgaeenlfvnapyvltpteytdpeqlaclrsvleplgvkiylc
Timeline for d2f1kc2: