| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.12: TyrA dimerization domain-like [140780] (1 protein) new dimerisation mode with swapping of C-terminal helices |
| Protein Prephenate dehydrogenase TyrA [140781] (3 species) |
| Species Synechocystis sp. PCC 6803 [TaxId:1148] [140783] (1 PDB entry) Uniprot P73906 166-279 |
| Domain d2f1kc1: 2f1k C:166-278 [132776] Other proteins in same PDB: d2f1ka2, d2f1kb2, d2f1kc2, d2f1kd2 automated match to d2f1ka1 complexed with nap, trs |
PDB Entry: 2f1k (more details), 1.55 Å
SCOPe Domain Sequences for d2f1kc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1kc1 a.100.1.12 (C:166-278) Prephenate dehydrogenase TyrA {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tpadhdqavawishlpvmvsaaliqacagekdgdilklaqnlassgfrdtsrvgggnpel
gtmmatynqrallkslqdyrqhldqlitlisnqqwpelhrllqqtngdrdkyv
Timeline for d2f1kc1: