| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
| Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (17 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
| Protein Prephenate dehydrogenase TyrA [141929] (2 species) |
| Species Synechocystis sp. pcc 6803 [TaxId:1148] [141931] (1 PDB entry) |
| Domain d2f1kb2: 2f1k B:1-165 [132775] Other proteins in same PDB: d2f1ka1, d2f1kb1, d2f1kc1, d2f1kd1 automatically matched to 2F1K A:1-165 complexed with nap, trs |
PDB Entry: 2f1k (more details), 1.55 Å
SCOP Domain Sequences for d2f1kb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1kb2 c.2.1.6 (B:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]}
mkigvvglgligaslagdlrrrghyligvsrqqstcekaverqlvdeagqdlsllqtaki
iflctpiqlilptlekliphlsptaivtdvasvktaiaepasqlwsgfigghpmagtaaq
gidgaeenlfvnapyvltpteytdpeqlaclrsvleplgvkiylc
Timeline for d2f1kb2: