![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.12: TyrA dimerization domain-like [140780] (1 protein) new dimerisation mode with swapping of C-terminal helices |
![]() | Protein Prephenate dehydrogenase TyrA [140781] (2 species) |
![]() | Species Synechocystis sp. pcc 6803 [TaxId:1148] [140783] (1 PDB entry) |
![]() | Domain d2f1kb1: 2f1k B:166-279 [132774] Other proteins in same PDB: d2f1ka2, d2f1kb2, d2f1kc2, d2f1kd2 automatically matched to 2F1K A:166-279 complexed with nap, trs |
PDB Entry: 2f1k (more details), 1.55 Å
SCOP Domain Sequences for d2f1kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1kb1 a.100.1.12 (B:166-279) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} tpadhdqavawishlpvmvsaaliqacagekdgdilklaqnlassgfrdtsrvgggnpel gtmmatynqrallkslqdyrqhldqlitlisnqqwpelhrllqqtngdrdkyve
Timeline for d2f1kb1: