Lineage for d2f1kb1 (2f1k B:166-279)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645590Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 645591Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 645754Family a.100.1.12: TyrA dimerization domain-like [140780] (1 protein)
    new dimerisation mode with swapping of C-terminal helices
  6. 645755Protein Prephenate dehydrogenase TyrA [140781] (2 species)
  7. 645761Species Synechocystis sp. pcc 6803 [TaxId:1148] [140783] (1 PDB entry)
  8. 645763Domain d2f1kb1: 2f1k B:166-279 [132774]
    Other proteins in same PDB: d2f1ka2, d2f1kb2, d2f1kc2, d2f1kd2
    automatically matched to 2F1K A:166-279
    complexed with nap, trs

Details for d2f1kb1

PDB Entry: 2f1k (more details), 1.55 Å

PDB Description: crystal structure of synechocystis arogenate dehydrogenase
PDB Compounds: (B:) prephenate dehydrogenase

SCOP Domain Sequences for d2f1kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1kb1 a.100.1.12 (B:166-279) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]}
tpadhdqavawishlpvmvsaaliqacagekdgdilklaqnlassgfrdtsrvgggnpel
gtmmatynqrallkslqdyrqhldqlitlisnqqwpelhrllqqtngdrdkyve

SCOP Domain Coordinates for d2f1kb1:

Click to download the PDB-style file with coordinates for d2f1kb1.
(The format of our PDB-style files is described here.)

Timeline for d2f1kb1: