Lineage for d2f1ja1 (2f1j A:5-64)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 642970Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 642971Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
  6. 642972Protein DNA repair protein Rad51, N-terminal domain [47796] (4 species)
  7. 642973Species Archaeon Methanococcus voltae [TaxId:2188] [109872] (7 PDB entries)
  8. 642976Domain d2f1ja1: 2f1j A:5-64 [132770]
    Other proteins in same PDB: d2f1ja2
    automatically matched to d1t4ga1
    complexed with adp, mg; mutant

Details for d2f1ja1

PDB Entry: 2f1j (more details), 2.3 Å

PDB Description: recombinase in complex with adp
PDB Compounds: (A:) DNA repair and recombination protein radA

SCOP Domain Sequences for d2f1ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1ja1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]}
ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlgf

SCOP Domain Coordinates for d2f1ja1:

Click to download the PDB-style file with coordinates for d2f1ja1.
(The format of our PDB-style files is described here.)

Timeline for d2f1ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f1ja2