SCOPe 2.08: Domain d2f1ja1: 2f1j A:5-63

Lineage for d2f1ja1 (2f1j A:5-63)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.0: automated matches [227240] (1 protein)
   not a true family

6. Protein automated matches [227003] (2 species)
   not a true protein

7. Species Methanococcus voltae [TaxId:2188] [255160] (3 PDB entries)

8. Domain d2f1ja1: 2f1j A:5-63 [132770]
   Other proteins in same PDB: d2f1ja2
   automated match to d3ewaa1
   complexed with adp, mg

Details for d2f1ja1

PDB Entry: 2f1j, 2.3 Å

PDB Description: recombinase in complex with adp

PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d2f1ja1:

Sequence; same for both SEQRES and ATOM records:

>d2f1ja1 a.60.4.0 (A:5-63) automated matches {Methanococcus voltae [TaxId: 2188]}
ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlg

Timeline for d2f1ja1:

• d2f1ja1 first appeared in SCOP 1.73
  
• d2f1ja1 appears in SCOPe 2.07