Lineage for d2f1ha1 (2f1h A:5-63)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715792Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715840Family a.60.4.0: automated matches [227240] (1 protein)
    not a true family
  6. 2715841Protein automated matches [227003] (2 species)
    not a true protein
  7. 2715846Species Methanococcus voltae [TaxId:2188] [255160] (3 PDB entries)
  8. 2715848Domain d2f1ha1: 2f1h A:5-63 [132766]
    Other proteins in same PDB: d2f1ha2
    automated match to d3ewaa1
    complexed with anp, k, mg

Details for d2f1ha1

PDB Entry: 2f1h (more details), 2.7 Å

PDB Description: recombinase in complex with amp-pnp and potassium
PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d2f1ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1ha1 a.60.4.0 (A:5-63) automated matches {Methanococcus voltae [TaxId: 2188]}
ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlg

SCOPe Domain Coordinates for d2f1ha1:

Click to download the PDB-style file with coordinates for d2f1ha1.
(The format of our PDB-style files is described here.)

Timeline for d2f1ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f1ha2