![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.4.0: automated matches [227240] (1 protein) not a true family |
![]() | Protein automated matches [227003] (2 species) not a true protein |
![]() | Species Methanococcus voltae [TaxId:2188] [255160] (3 PDB entries) |
![]() | Domain d2f1ha1: 2f1h A:5-63 [132766] Other proteins in same PDB: d2f1ha2 automated match to d3ewaa1 complexed with anp, k, mg |
PDB Entry: 2f1h (more details), 2.7 Å
SCOPe Domain Sequences for d2f1ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1ha1 a.60.4.0 (A:5-63) automated matches {Methanococcus voltae [TaxId: 2188]} ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlg
Timeline for d2f1ha1: