SCOPe 2.08: Domain d2f1gb_: 2f1g B:

Lineage for d2f1gb_ (2f1g B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)

8. Domain d2f1gb_: 2f1g B: [132765]
   automated match to d1ms6a_
   complexed with gnf, gol

Details for d2f1gb_

PDB Entry: 2f1g, 1.9 Å

PDB Description: Cathepsin S in complex with non-covalent 2-(Benzoxazol-2-ylamino)-acetamide

PDB Compounds: (B:) cathepsin S

SCOPe Domain Sequences for d2f1gb_:

Sequence; same for both SEQRES and ATOM records:

>d2f1gb_ d.3.1.1 (B:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2f1gb_:

• d2f1gb_ first appeared in SCOP 1.73, called d2f1gb1
  
• d2f1gb_ appears in SCOPe 2.07