![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein (Pro)cathepsin S [82566] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries) |
![]() | Domain d2f1gb_: 2f1g B: [132765] automated match to d1ms6a_ complexed with gnf, gol |
PDB Entry: 2f1g (more details), 1.9 Å
SCOPe Domain Sequences for d2f1gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1gb_ d.3.1.1 (B:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw lvknswghnfgeegyirmarnkgnhcgiasfpsypei
Timeline for d2f1gb_: