SCOPe 2.07: Domain d2f1ga_: 2f1g A:

Lineage for d2f1ga_ (2f1g A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)

8. Domain d2f1ga_: 2f1g A: [132764]
   automated match to d1ms6a_
   complexed with gnf, gol

Details for d2f1ga_

PDB Entry: 2f1g, 1.9 Å

PDB Description: Cathepsin S in complex with non-covalent 2-(Benzoxazol-2-ylamino)-acetamide

PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d2f1ga_:

Sequence; same for both SEQRES and ATOM records:

>d2f1ga_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
nrilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcs
tekygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelp
ygredvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngk
eywlvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2f1ga_:

• d2f1ga_ first appeared in SCOP 1.73, called d2f1ga1
  
• d2f1ga_ appears in SCOPe 2.06
  
• d2f1ga_ appears in the current release, SCOPe 2.08