SCOP 1.73: Domain d2f1fb2: 2f1f B:78-158

Lineage for d2f1fb2 (2f1f B:78-158)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (12 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.6: IlvH-like [143376] (1 protein)
   Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes

6. Protein Acetolactate synthase small subunit, IlvH [143377] (3 species)

7. Species Escherichia coli [TaxId:562] [143379] (1 PDB entry)

8. Domain d2f1fb2: 2f1f B:78-158 [132763]
   automatically matched to 2F1F A:78-163
   complexed with 1pe, mg, p33

Details for d2f1fb2

PDB Entry: 2f1f, 1.75 Å

PDB Description: crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli

PDB Compounds: (B:) Acetolactate synthase isozyme III small subunit

SCOP Domain Sequences for d2f1fb2:

Sequence; same for both SEQRES and ATOM records:

>d2f1fb2 d.58.18.6 (B:78-158) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]}
qgahvereimlvkiqasgygrdevkrnteifrgqiidvtpslytvqlagtsgkldaflas
irdvakivevarsgvvglsrg

Timeline for d2f1fb2:

• d2f1fb2 is new in SCOP 1.73
  
• d2f1fb2 appears in SCOP 1.75
  
• d2f1fb2 appears in the current release, SCOPe 2.08