Lineage for d2f1fb1 (2f1f B:2-77)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725281Superfamily d.58.18: ACT-like [55021] (12 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 725358Family d.58.18.6: IlvH-like [143376] (1 protein)
    Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes
  6. 725359Protein Acetolactate synthase small subunit, IlvH [143377] (3 species)
  7. 725360Species Escherichia coli [TaxId:562] [143379] (1 PDB entry)
  8. 725363Domain d2f1fb1: 2f1f B:2-77 [132762]
    automatically matched to 2F1F A:2-77
    complexed with 1pe, mg, p33

Details for d2f1fb1

PDB Entry: 2f1f (more details), 1.75 Å

PDB Description: crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli
PDB Compounds: (B:) Acetolactate synthase isozyme III small subunit

SCOP Domain Sequences for d2f1fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1fb1 d.58.18.6 (B:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]}
rrilsvllenesgalsrviglfsqrgyniesltvaptddptlsrmtiqtvgdekvleqie
kqlhklvdvlrvselg

SCOP Domain Coordinates for d2f1fb1:

Click to download the PDB-style file with coordinates for d2f1fb1.
(The format of our PDB-style files is described here.)

Timeline for d2f1fb1:

Domains from same chain:
(mouse over for more information)
d2f1fb2
Domains from other chains:
(mouse over for more information)
d2f1fa1, d2f1fa2