![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (14 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.6: IlvH-like [143376] (1 protein) Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes |
![]() | Protein Acetolactate synthase small subunit, IlvH [143377] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [143379] (1 PDB entry) Uniprot P00894 2-77! Uniprot P00894 78-163 |
![]() | Domain d2f1fa1: 2f1f A:2-77 [132760] complexed with 1pe, mg, p33 |
PDB Entry: 2f1f (more details), 1.75 Å
SCOP Domain Sequences for d2f1fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} rrilsvllenesgalsrviglfsqrgyniesltvaptddptlsrmtiqtvgdekvleqie kqlhklvdvlrvselg
Timeline for d2f1fa1: