SCOP 1.75: Domain d2f1fa1: 2f1f A:2-77

Lineage for d2f1fa1 (2f1f A:2-77)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (14 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.6: IlvH-like [143376] (1 protein)
   Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes

6. Protein Acetolactate synthase small subunit, IlvH [143377] (3 species)

7. Species Escherichia coli [TaxId:562] [143379] (1 PDB entry)
   Uniprot P00894 2-77! Uniprot P00894 78-163

8. Domain d2f1fa1: 2f1f A:2-77 [132760]
   complexed with 1pe, mg, p33

Details for d2f1fa1

PDB Entry: 2f1f, 1.75 Å

PDB Description: crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli

PDB Compounds: (A:) Acetolactate synthase isozyme III small subunit

SCOP Domain Sequences for d2f1fa1:

Sequence; same for both SEQRES and ATOM records:

>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]}
rrilsvllenesgalsrviglfsqrgyniesltvaptddptlsrmtiqtvgdekvleqie
kqlhklvdvlrvselg

Timeline for d2f1fa1:

• d2f1fa1 first appeared in SCOP 1.73
  
• d2f1fa1 appears in SCOPe 2.01
  
• d2f1fa1 appears in the current release, SCOPe 2.08