Lineage for d2f1do1 (2f1d O:10-95)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716989Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein)
    duplication; there are two structural repeats of this fold
  6. 716990Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)
  7. 717009Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142926] (1 PDB entry)
  8. 717038Domain d2f1do1: 2f1d O:10-95 [132756]
    automatically matched to 2F1D A:10-95
    complexed with mn, so4

Details for d2f1do1

PDB Entry: 2f1d (more details), 3 Å

PDB Description: X-Ray Structure of imidazoleglycerol-phosphate dehydratase
PDB Compounds: (O:) Imidazoleglycerol-phosphate dehydratase 1

SCOP Domain Sequences for d2f1do1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1do1 d.14.1.9 (O:10-95) Imidazole glycerol phosphate dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
iddhhtnedialaigtallkalgerk

SCOP Domain Coordinates for d2f1do1:

Click to download the PDB-style file with coordinates for d2f1do1.
(The format of our PDB-style files is described here.)

Timeline for d2f1do1: