![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins) duplication; there are two structural repeats of this fold |
![]() | Protein automated matches [254526] (1 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (7 PDB entries) |
![]() | Domain d2f1dn1: 2f1d N:10-95 [132754] Other proteins in same PDB: d2f1da1, d2f1da2 automated match to d2f1da1 complexed with mn, so4 |
PDB Entry: 2f1d (more details), 3 Å
SCOPe Domain Sequences for d2f1dn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1dn1 d.14.1.9 (N:10-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh iddhhtnedialaigtallkalgerk
Timeline for d2f1dn1:
![]() Domains from other chains: (mouse over for more information) d2f1da1, d2f1da2, d2f1db1, d2f1db2, d2f1dc1, d2f1dc2, d2f1dd1, d2f1dd2, d2f1de1, d2f1de2, d2f1df1, d2f1df2, d2f1dg1, d2f1dg2, d2f1dh1, d2f1dh2, d2f1di1, d2f1di2, d2f1dj1, d2f1dj2, d2f1dk1, d2f1dk2, d2f1dl1, d2f1dl2, d2f1dm1, d2f1dm2, d2f1do1, d2f1do2, d2f1dp1, d2f1dp2 |