SCOPe 2.08: Domain d2f1dg1: 2f1d G:10-95

Lineage for d2f1dg1 (2f1d G:10-95)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
   duplication; there are two structural repeats of this fold

6. Protein automated matches [254526] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (11 PDB entries)

8. Domain d2f1dg1: 2f1d G:10-95 [132740]
   Other proteins in same PDB: d2f1da1, d2f1da2
   automated match to d2f1da1
   complexed with mn, so4

Details for d2f1dg1

PDB Entry: 2f1d, 3 Å

PDB Description: X-Ray Structure of imidazoleglycerol-phosphate dehydratase

PDB Compounds: (G:) Imidazoleglycerol-phosphate dehydratase 1

SCOPe Domain Sequences for d2f1dg1:

Sequence; same for both SEQRES and ATOM records:

>d2f1dg1 d.14.1.9 (G:10-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
iddhhtnedialaigtallkalgerk

Timeline for d2f1dg1:

• d2f1dg1 first appeared in SCOP 1.73
  
• d2f1dg1 appears in SCOPe 2.07