SCOPe 2.08: Domain d2f1da1: 2f1d A:10-95

Lineage for d2f1da1 (2f1d A:10-95)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
   duplication; there are two structural repeats of this fold

6. Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142926] (1 PDB entry)
   Uniprot P34047 159-255! Uniprot P34047 73-158

8. Domain d2f1da1: 2f1d A:10-95 [132728]
   Other proteins in same PDB: d2f1db1, d2f1db2, d2f1dc1, d2f1dc2, d2f1dd1, d2f1dd2, d2f1de1, d2f1de2, d2f1df1, d2f1df2, d2f1dg1, d2f1dg2, d2f1dh1, d2f1dh2, d2f1di1, d2f1di2, d2f1dj1, d2f1dj2, d2f1dk1, d2f1dk2, d2f1dl1, d2f1dl2, d2f1dm1, d2f1dm2, d2f1dn1, d2f1dn2, d2f1do1, d2f1do2, d2f1dp1, d2f1dp2
   complexed with mn, so4

Details for d2f1da1

PDB Entry: 2f1d, 3 Å

PDB Description: X-Ray Structure of imidazoleglycerol-phosphate dehydratase

PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 1

SCOPe Domain Sequences for d2f1da1:

Sequence; same for both SEQRES and ATOM records:

>d2f1da1 d.14.1.9 (A:10-95) Imidazole glycerol phosphate dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
iddhhtnedialaigtallkalgerk

Timeline for d2f1da1:

• d2f1da1 first appeared in SCOP 1.73
  
• d2f1da1 appears in SCOPe 2.07