SCOPe 2.08: Domain d2f1ba3: 2f1b A:31-411

Lineage for d2f1ba3 (2f1b A:31-411)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.1: alpha-mannosidase [88714] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family

6. Protein Golgi alpha-mannosidase II [88715] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (57 PDB entries)
   Uniprot Q24451 94-1107

8. Domain d2f1ba3: 2f1b A:31-411 [132727]
   Other proteins in same PDB: d2f1ba1, d2f1ba2
   automated match to d1qwna3
   complexed with gb3, mpd, nag, zn

Details for d2f1ba3

PDB Entry: 2f1b, 1.45 Å

PDB Description: golgi alpha-mannosidase ii complex with (2r,3r,4s,5r)-2-({[(1r)-2- hydroxy-1-phenylethyl]amino}methyl)-5-methylpyrrolidine-3,4-diol

PDB Compounds: (A:) Alpha-mannosidase II

SCOPe Domain Sequences for d2f1ba3:

Sequence; same for both SEQRES and ATOM records:

>d2f1ba3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
ragqaefptlsgdfftyadrs

Timeline for d2f1ba3:

• d2f1ba3 first appeared in SCOP 1.73
  
• d2f1ba3 appears in SCOPe 2.07