Lineage for d2f1ba2 (2f1b A:523-1044)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782343Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1782676Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 1782677Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 1782678Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 1782711Domain d2f1ba2: 2f1b A:523-1044 [132726]
    Other proteins in same PDB: d2f1ba1, d2f1ba3
    automated match to d1qwna2
    complexed with gb3, mpd, nag, zn

Details for d2f1ba2

PDB Entry: 2f1b (more details), 1.45 Å

PDB Description: golgi alpha-mannosidase ii complex with (2r,3r,4s,5r)-2-({[(1r)-2- hydroxy-1-phenylethyl]amino}methyl)-5-methylpyrrolidine-3,4-diol
PDB Compounds: (A:) Alpha-mannosidase II

SCOPe Domain Sequences for d2f1ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1ba2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOPe Domain Coordinates for d2f1ba2:

Click to download the PDB-style file with coordinates for d2f1ba2.
(The format of our PDB-style files is described here.)

Timeline for d2f1ba2: