![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
![]() | Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (7 families) ![]() in the different families beta-barrels are similarly distorted but may vary in the number of strands |
![]() | Family c.6.2.1: alpha-mannosidase [88714] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family |
![]() | Protein Golgi alpha-mannosidase II [88715] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (23 PDB entries) |
![]() | Domain d2f18a3: 2f18 A:31-411 [132721] Other proteins in same PDB: d2f18a1, d2f18a2 automatically matched to d1htya3 complexed with gb1, mpd, nag, po4, zn |
PDB Entry: 2f18 (more details), 1.3 Å
SCOP Domain Sequences for d2f18a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f18a3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae ragqaefptlsgdfftyadrs
Timeline for d2f18a3: