Lineage for d2f18a2 (2f18 A:523-1044)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664501Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 664771Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 664772Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 664773Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (23 PDB entries)
  8. 664779Domain d2f18a2: 2f18 A:523-1044 [132720]
    Other proteins in same PDB: d2f18a1, d2f18a3
    automatically matched to d1htya2
    complexed with gb1, mpd, nag, po4, zn

Details for d2f18a2

PDB Entry: 2f18 (more details), 1.3 Å

PDB Description: golgi alpha-mannosidase ii complex with (2r,3r,4s)-2-({[(1r)-2- hydroxy-1-phenylethyl]amino}methyl)pyrrolidine-3,4-diol
PDB Compounds: (A:) Alpha-mannosidase II

SCOP Domain Sequences for d2f18a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f18a2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOP Domain Coordinates for d2f18a2:

Click to download the PDB-style file with coordinates for d2f18a2.
(The format of our PDB-style files is described here.)

Timeline for d2f18a2: