Class a: All alpha proteins [46456] (290 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) |
Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family |
Protein Golgi alpha-mannosidase II [88694] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (57 PDB entries) Uniprot Q24451 94-1107 |
Domain d2f18a1: 2f18 A:412-522 [132719] Other proteins in same PDB: d2f18a2, d2f18a3 automated match to d1qwna1 complexed with gb1, mpd, nag, po4, zn |
PDB Entry: 2f18 (more details), 1.3 Å
SCOPe Domain Sequences for d2f18a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f18a1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs
Timeline for d2f18a1: