![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.100: Thiamin pyrophosphokinase, catalytic domain [63998] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 432156 |
![]() | Superfamily c.100.1: Thiamin pyrophosphokinase, catalytic domain [63999] (1 family) ![]() |
![]() | Family c.100.1.1: Thiamin pyrophosphokinase, catalytic domain [64000] (1 protein) |
![]() | Protein Thiamin pyrophosphokinase, catalytic domain [64001] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [64002] (2 PDB entries) |
![]() | Domain d2f17a2: 2f17 A:-9-158 [132718] Other proteins in same PDB: d2f17a1, d2f17a3, d2f17b2 automated match to d1ig3a2 complexed with amp, epe, mg, pyi, so4 |
PDB Entry: 2f17 (more details), 2.5 Å
SCOPe Domain Sequences for d2f17a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f17a2 c.100.1.1 (A:-9-158) Thiamin pyrophosphokinase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]} ssglvprgshmehaftplepllptgnlkyclvvlnqpldarfrhlwkkallracadggan hlydltegeresflpefvsgdfdsirpevkeyytkkgcdlistpdqdhtdftkclqvlqr kieekelqvdvivtlgglggrfdqimasvntlfqathitpvpiiiiqk
Timeline for d2f17a2: