Lineage for d2f17a2 (2f17 A:-9-158)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919028Fold c.100: Thiamin pyrophosphokinase, catalytic domain [63998] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 432156
  4. 2919029Superfamily c.100.1: Thiamin pyrophosphokinase, catalytic domain [63999] (1 family) (S)
  5. 2919030Family c.100.1.1: Thiamin pyrophosphokinase, catalytic domain [64000] (1 protein)
  6. 2919031Protein Thiamin pyrophosphokinase, catalytic domain [64001] (3 species)
  7. 2919038Species Mouse (Mus musculus) [TaxId:10090] [64002] (2 PDB entries)
  8. 2919041Domain d2f17a2: 2f17 A:-9-158 [132718]
    Other proteins in same PDB: d2f17a1, d2f17a3, d2f17b2
    automated match to d1ig3a2
    complexed with amp, epe, mg, pyi, so4

Details for d2f17a2

PDB Entry: 2f17 (more details), 2.5 Å

PDB Description: Mouse Thiamin Pyrophosphokinase in a Ternary Complex with Pyrithiamin Pyrophosphate and AMP at 2.5 angstrom
PDB Compounds: (A:) Thiamin pyrophosphokinase 1

SCOPe Domain Sequences for d2f17a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f17a2 c.100.1.1 (A:-9-158) Thiamin pyrophosphokinase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}
ssglvprgshmehaftplepllptgnlkyclvvlnqpldarfrhlwkkallracadggan
hlydltegeresflpefvsgdfdsirpevkeyytkkgcdlistpdqdhtdftkclqvlqr
kieekelqvdvivtlgglggrfdqimasvntlfqathitpvpiiiiqk

SCOPe Domain Coordinates for d2f17a2:

Click to download the PDB-style file with coordinates for d2f17a2.
(The format of our PDB-style files is described here.)

Timeline for d2f17a2: