SCOPe 2.07: Domain d2f17a1: 2f17 A:159-243

Lineage for d2f17a1 (2f17 A:159-243)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family)

5. Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein)

6. Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [63865] (2 PDB entries)

8. Domain d2f17a1: 2f17 A:159-243 [132717]
   Other proteins in same PDB: d2f17a2, d2f17a3, d2f17b1
   automated match to d1ig3a1
   complexed with amp, epe, mg, pyi, so4

Details for d2f17a1

PDB Entry: 2f17, 2.5 Å

PDB Description: Mouse Thiamin Pyrophosphokinase in a Ternary Complex with Pyrithiamin Pyrophosphate and AMP at 2.5 angstrom

PDB Compounds: (A:) Thiamin pyrophosphokinase 1

SCOPe Domain Sequences for d2f17a1:

Sequence; same for both SEQRES and ATOM records:

>d2f17a1 b.82.6.1 (A:159-243) Thiamin pyrophosphokinase, substrate-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
dsliyllqpgkhrlhvdtgmegswcglipvgqpcnqvtttglkwnltndvlgfgtlvsts
ntydgsglvtvetdhpllwtmaiks

Timeline for d2f17a1:

• d2f17a1 first appeared in SCOP 1.73
  
• d2f17a1 appears in SCOPe 2.06
  
• d2f17a1 appears in the current release, SCOPe 2.08