Lineage for d2f17a1 (2f17 A:159-243)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2817314Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family) (S)
  5. 2817315Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein)
  6. 2817316Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species)
  7. 2817323Species Mouse (Mus musculus) [TaxId:10090] [63865] (2 PDB entries)
  8. 2817326Domain d2f17a1: 2f17 A:159-243 [132717]
    Other proteins in same PDB: d2f17a2, d2f17a3, d2f17b1
    automated match to d1ig3a1
    complexed with amp, epe, mg, pyi, so4

Details for d2f17a1

PDB Entry: 2f17 (more details), 2.5 Å

PDB Description: Mouse Thiamin Pyrophosphokinase in a Ternary Complex with Pyrithiamin Pyrophosphate and AMP at 2.5 angstrom
PDB Compounds: (A:) Thiamin pyrophosphokinase 1

SCOPe Domain Sequences for d2f17a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f17a1 b.82.6.1 (A:159-243) Thiamin pyrophosphokinase, substrate-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
dsliyllqpgkhrlhvdtgmegswcglipvgqpcnqvtttglkwnltndvlgfgtlvsts
ntydgsglvtvetdhpllwtmaiks

SCOPe Domain Coordinates for d2f17a1:

Click to download the PDB-style file with coordinates for d2f17a1.
(The format of our PDB-style files is described here.)

Timeline for d2f17a1: