Lineage for d2f16u_ (2f16 U:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2993454Domain d2f16u_: 2f16 U: [132711]
    Other proteins in same PDB: d2f161_, d2f162_, d2f16a_, d2f16b_, d2f16c_, d2f16d_, d2f16e_, d2f16f_, d2f16h_, d2f16i_, d2f16j_, d2f16k_, d2f16l_, d2f16m_, d2f16n_, d2f16o_, d2f16p_, d2f16q_, d2f16r_, d2f16s_, d2f16t_, d2f16v_, d2f16w_, d2f16x_, d2f16y_, d2f16z_
    automated match to d1g65g_
    complexed with bo2

Details for d2f16u_

PDB Entry: 2f16 (more details), 2.8 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with bortezomib
PDB Compounds: (U:) Proteasome component C7-alpha

SCOPe Domain Sequences for d2f16u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f16u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d2f16u_:

Click to download the PDB-style file with coordinates for d2f16u_.
(The format of our PDB-style files is described here.)

Timeline for d2f16u_: