Lineage for d2f0yb_ (2f0y B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004426Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2004554Family a.102.4.3: Protein prenyltransferases [48246] (3 protein domains)
  6. 2004555Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 2004556Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries)
    Uniprot P49356
  8. 2004568Domain d2f0yb_: 2f0y B: [132682]
    Other proteins in same PDB: d2f0ya_
    automated match to d1tn6b_
    complexed with 3mn, fpp, zn

Details for d2f0yb_

PDB Entry: 2f0y (more details), 2.7 Å

PDB Description: Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate and hydantoin derivative
PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d2f0yb_:

Sequence, based on SEQRES records: (download)

>d2f0yb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh
ylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspeggf
gggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmhvggevd
vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv
ilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd
palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga
mlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvp

Sequence, based on observed residues (ATOM records): (download)

>d2f0yb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
eplyslrpeharerlqddsvetvtsieqakveekiqevfssykrlvlqrekhfhylkrgl
rqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspeggfgggpgq
yphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmhvggevdvrsayc
aasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvilkrer
slnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpalsms
hwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgamlhdvv
lgvpenalqpthpvynigpdkviqattyflqkpvp

SCOPe Domain Coordinates for d2f0yb_:

Click to download the PDB-style file with coordinates for d2f0yb_.
(The format of our PDB-style files is described here.)

Timeline for d2f0yb_: