Lineage for d2f0ya_ (2f0y A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339381Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2339382Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 2339505Protein automated matches [254525] (2 species)
    not a true protein
  7. 2339506Species Human (Homo sapiens) [TaxId:9606] [255157] (1 PDB entry)
  8. 2339507Domain d2f0ya_: 2f0y A: [132681]
    Other proteins in same PDB: d2f0yb_
    automated match to d1d8da_
    complexed with 3mn, fpp, zn

Details for d2f0ya_

PDB Entry: 2f0y (more details), 2.7 Å

PDB Description: Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate and hydantoin derivative
PDB Compounds: (A:) Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit

SCOPe Domain Sequences for d2f0ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f0ya_ a.118.6.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOPe Domain Coordinates for d2f0ya_:

Click to download the PDB-style file with coordinates for d2f0ya_.
(The format of our PDB-style files is described here.)

Timeline for d2f0ya_: